PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM09G14010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 275aa    MW: 29264.1 Da    PI: 4.3585
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM09G14010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.8e-1951104356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  OGLUM09G14010.1  51 KKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 104
                      456899***********************************************9 PP

2HD-ZIP_I/II132.81.3e-4250142193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrls eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++yd+l+ ++++L++++++L +e+ke
  OGLUM09G14010.1  50 EKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDSLRLDHDALRRDKDALLAEIKE 142
                      69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.3E-1939108IPR009057Homeodomain-like
PROSITE profilePS5007117.29746106IPR001356Homeobox domain
SMARTSM003892.1E-1849110IPR001356Homeobox domain
CDDcd000866.45E-1851107No hitNo description
PfamPF000462.9E-1651104IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-1953113IPR009057Homeodomain-like
PRINTSPR000319.4E-67786IPR000047Helix-turn-helix motif
PROSITE patternPS00027081104IPR017970Homeobox, conserved site
PRINTSPR000319.4E-686102IPR000047Helix-turn-helix motif
PfamPF021835.3E-17106147IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MKRPGGAGGG GGSPSLVTMA NSSDDGYGGV GMEAEGDVEE EMMACGGGGE KKRRLSVEQV  60
RALERSFEVE NKLEPERKAR LARDLGLQPR QVAVWFQNRR ARWKTKQLER DYAALRHSYD  120
SLRLDHDALR RDKDALLAEI KELKAKLGDE EAAASFTSVK EEPAASDGPP AAGFGSSDSD  180
SSAVLNDVDA AGAAPAATDA LAPEACTFLG APPAAGAGAA AAASHEEVFF HGNFLKVEED  240
ETGFLDDDEP CGGFFADDQP PPLSSWWAEP TEHWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17581ERKARLA
298106RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0997100.0AK099710.1 Oryza sativa Japonica Group cDNA clone:J013077J22, full insert sequence.
GenBankAK1054840.0AK105484.1 Oryza sativa Japonica Group cDNA clone:001-127-B05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612509.11e-161PREDICTED: homeobox-leucine zipper protein HOX4
SwissprotQ6K4981e-163HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4
SwissprotQ9XH371e-163HOX4_ORYSI; Homeobox-leucine zipper protein HOX4
TrEMBLA0A0E0B4520.0A0A0E0B452_9ORYZ; Uncharacterized protein
STRINGORGLA09G0102600.11e-161(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-39homeobox protein 16